PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_031517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family YABBY
Protein Properties Length: 193aa    MW: 21293.2 Da    PI: 8.3964
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_031517genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY233.64.7e-72131762170
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                  + fs s+q+Cyv+C+fC+t+lavsvP +sl+++vtvrCGhCt+l++  ++++s ll+  ++l+++l +++ + ++ ++++ + + ++++s++ s    
  DCAR_031517  13 HSFSPSDQLCYVNCSFCHTVLAVSVPCSSLSRTVTVRCGHCTNLFT--VNMRSLLLPPPNQLGNNLFPPQNHAEEIRGSASDNMFMNQTSPTDSLIP- 107
                  56899***************************************99..6688999*************99999999999888888888777766554. PP

        YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     +   +e+p++p ++rPPekrqrvPsaynrfikeeiqrika+nP+ishreafsaaaknWahfP+ihfgl
  DCAR_031517 108 --IRGGVNELPKPPATNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPEISHREAFSAAAKNWAHFPNIHFGL 176
                  ..35678899**99*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.7E-6817176IPR006780YABBY protein
SuperFamilySSF470958.64E-8121170IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.107.4E-5123170IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSSSQAFSPP DLHSFSPSDQ LCYVNCSFCH TVLAVSVPCS SLSRTVTVRC GHCTNLFTVN  60
MRSLLLPPPN QLGNNLFPPQ NHAEEIRGSA SDNMFMNQTS PTDSLIPIRG GVNELPKPPA  120
TNRPPEKRQR VPSAYNRFIK EEIQRIKAGN PEISHREAFS AAAKNWAHFP NIHFGLLPDE  180
SAFRVSREPI LV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090395.16e-91PREDICTED: axial regulator YABBY 1
SwissprotO221526e-70YAB1_ARATH; Axial regulator YABBY 1
TrEMBLQ6SS005e-91Q6SS00_ANTMA; YABBY-like transcription factor GRAMINIFOLIA
STRINGVIT_15s0048g00550.t014e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.12e-63YABBY family protein